Total number of results for Aedes aegypti are 75
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00232 |
QLTFTPSW
|
8 | Aedes aegypti | AKH/HRTH/RPCH | Adipokinetic hormone 1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00236 |
SRPYSFGL
|
8 | Aedes aegypti | Allatostatin | Allatostatin | 9357049#Veenstra JA, Noriega FG, Graf R, Feyereisen R#Identification of three allatostatins and their cDNA from the mosquito Aedes aegypti#Peptides 1997;18(7):937-42 | |
| NP00270 |
SPKYNFGL
|
8 | Aedes aegypti | Allatostatin | Allatostatin 1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00271 |
LPHYNFGL
|
8 | Aedes aegypti | Allatostatin | Allatostatin 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00272 |
ASAYRYHFGL
|
10 | Aedes aegypti | Allatostatin | Allatostatin 3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00273 |
QIRYRQCYFNPISCF
|
15 | Aedes aegypti | Allatostatin | Allatostatin C | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00274 |
RVYDFGL
|
7 | Aedes aegypti | Allatostatin | Allatostatin-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00275 |
LPNRYNFGL
|
9 | Aedes aegypti | Allatostatin | Allatostatin-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00276 |
VYEDKRLPNRYNFGL
|
15 | Aedes aegypti | Allatostatin | AST-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00277 |
TWKNLQGGW
|
9 | Aedes aegypti | Allatostatin | MIP-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00278 |
AWNKINGGW
|
9 | Aedes aegypti | Allatostatin | MIP-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00279 |
VNAGPAQWNKFRGSW
|
15 | Aedes aegypti | Allatostatin | MIP-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00280 |
EPGWNNLKGLW
|
11 | Aedes aegypti | Allatostatin | MIP-4b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00281 |
SEKWNKLSSSW
|
11 | Aedes aegypti | Allatostatin | MIP-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00732 |
NSELINSLLSLPKKLNDA
|
18 | Aedes aegypti | Arthropod PDH | Pigment-dispersing hormone | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP00860 |
TVDFGLSRGYSGAQEAKHRMAMAVANFAGGP
|
31 | Aedes aegypti | Calcitonin-like peptide | Diuretic hormone 31 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01039 |
QTFQYSRGWTN
|
11 | Aedes aegypti | Corazonin | Corazonin | ||
| NP01040 |
SSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQ
|
32 | Aedes aegypti | Corazonin | Corazonin precursor-related peptide | ||
| NP01041 |
QTFQYSRGWTNGKRSSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQRFLKSPCDVRLANAIVNRNKDLLRDMADDVNDGTALLYDPVPMVDTAASEDVRFKRGTPDRRLLNDGMHRL
|
117 | Aedes aegypti | Corazonin | Pro-corazonin (Potential) | ||
| NP01110 |
DETPGFFIKLSKSVPRI
|
17 | Aedes aegypti | Ecdysis triggering hormone | Ecdysis triggering hormone-1b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01111 |
GDFENFFLKQSKSVPRI
|
17 | Aedes aegypti | Ecdysis triggering hormone | Ecdysis triggering hormone-2b | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01146 |
FMRF
|
4 | Aedes aegypti | FMRFamide related peptide | FMRFamide | 3738889#Brown MR, Crim JW, Lea AO#FMRFamide- and pancreatic polypeptide-like immunoreactivity of endocrine cells in the midgut of a mosquito#Tissue Cell 1986;18(3):419-28 | |
| NP01250 |
GYRKPPFNGSIFG
|
13 | Aedes aegypti | FMRFamide related peptide | ext SIFa | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01251 |
SALDKNFMRF
|
10 | Aedes aegypti | FMRFamide related peptide | FMRFa-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01252 |
SDPRFLRLV
|
9 | Aedes aegypti | FMRFamide related peptide | FMRFa-10 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01253 |
MDNNFMRF
|
8 | Aedes aegypti | FMRFamide related peptide | FMRFa-11 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01254 |
DSPKNLMRF
|
9 | Aedes aegypti | FMRFamide related peptide | FMRFa-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01255 |
ANLMRF
|
6 | Aedes aegypti | FMRFamide related peptide | FMRFa-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01256 |
GSGNLMRF
|
8 | Aedes aegypti | FMRFamide related peptide | FMRFa-8 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01257 |
ASKQANLMRF
|
10 | Aedes aegypti | FMRFamide related peptide | FMRFamide-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01258 |
AGQGFMRF
|
8 | Aedes aegypti | FMRFamide related peptide | FMRFamide-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01259 |
DDTNKFLRLS
|
10 | Aedes aegypti | FMRFamide related peptide | FMRFamide-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01260 |
AGSEAGGNLQRTNFLRF
|
17 | Aedes aegypti | FMRFamide related peptide | FMRFamide-7 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01261 |
AKGNLMRF
|
8 | Aedes aegypti | FMRFamide related peptide | FMRFamide-9 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP01262 |
GYRKPPFNGSIF
|
12 | Aedes aegypti | FMRFamide related peptide | SIFamide | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02060 |
FDDYGHMRF
|
9 | Aedes aegypti | Gastrin/cholecystokinin | Sulfakinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02061 |
GGGGEGEQFDDYGHMRF
|
17 | Aedes aegypti | Gastrin/cholecystokinin | Sulfakinin-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02807 |
NTGRVHRQPKVVIRNPFHAWG
|
21 | Aedes aegypti | Kinin | Kin-3 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP02817 |
NSKYVSKQKFYSWG
|
14 | Aedes aegypti | Kinin | Leucokinin-1 | 8048942#Veenstra J.A.; #Isolation and identification of three leucokinins from the mosquito Aedes aegypti.; #Biochem. Biophys. Res. Commun. 202:715-719(1994). | |
| NP02818 |
NPFHAWG
|
7 | Aedes aegypti | Kinin | Leucokinin-2 | 8048942#Veenstra J.A.; #Isolation and identification of three leucokinins from the mosquito Aedes aegypti.; #Biochem. Biophys. Res. Commun. 202:715-719(1994). | |
| NP02819 |
NNPNVFYPWG
|
10 | Aedes aegypti | Kinin | Leucokinin-3 | 8048942#Veenstra J.A.; #Isolation and identification of three leucokinins from the mosquito Aedes aegypti.; #Biochem. Biophys. Res. Commun. 202:715-719(1994). | |
| NP03057 |
TDVDHVFLRF
|
10 | Aedes aegypti | Myosuppressin | Myosuppressin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03175 |
APFRNSEMMTARGF
|
14 | Aedes aegypti | NA | Allatotropin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03176 |
NIQSLLRTGMLPSIAPK
|
17 | Aedes aegypti | NA | ext NPLP-1-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03177 |
SYRSLLRDGATF
|
12 | Aedes aegypti | NA | NPLP-1-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03178 |
NLGSLARAGLLRTPSTDYL
|
19 | Aedes aegypti | NA | NPLP-1-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03179 |
NLASARASGYMLN
|
13 | Aedes aegypti | NA | NPLP-1-4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03180 |
NIASLARKYELP
|
12 | Aedes aegypti | NA | NPLP-1-5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03181 |
NIQSLLRTGMLPSIAP
|
16 | Aedes aegypti | NA | NPLP-1-6 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03182 |
NMQSLARDNSLPHFAGAAAQES
|
22 | Aedes aegypti | NA | NPLP-1-7 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03183 |
NIQTLVRDWNLPRQQSMAADNE
|
22 | Aedes aegypti | NA | NPLP-1-8 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03184 |
NIQSLKNAQGQGGGSSSG
|
18 | Aedes aegypti | NA | NPLP-1-9 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03802 |
KAVRSPSLRLRF
|
12 | Aedes aegypti | NPY | sNPF-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03803 |
SPSLRLRF
|
8 | Aedes aegypti | NPY | sNPF-1 4-11 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03804 |
APQLRLRF
|
8 | Aedes aegypti | NPY | sNPF-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP03835 |
QRPPSLKTRF
|
10 | Aedes aegypti | NPY | Decapeptide 1 | #Matsumoto S., Brown M.R., Crim J.W., Vigna S.R., Lea A.O.; #Isolation and primary structure of neuropeptides from the mosquito, Aedes aegypti, immunoreactive to FMRFamide antiserum.; #Insect Biochem. 19:277-283(1989). | |
| NP03836 |
AVRSPSLRLRF
|
11 | Aedes aegypti | NPY | RLRF peptide 1 (By similarity) | ||
| NP03837 |
SIRAPQLRLRF
|
11 | Aedes aegypti | NPY | RLRF peptide 2 (By similarity) | ||
| NP03838 |
AIRAPQLRLRF
|
11 | Aedes aegypti | NPY | RLRF peptide 3 (By similarity) | ||
| NP03839 |
APSQRLRW
|
8 | Aedes aegypti | NPY | RLRW peptide (By similarity) | ||
| NP03840 |
TDPLWSSFNENALLEE
|
16 | Aedes aegypti | NPY | sNPF peptide 2 (By similarity) | ||
| NP03841 |
SGGGMFSTNDVMQQ
|
14 | Aedes aegypti | NPY | sNPF peptide 3 (By similarity) | ||
| NP03842 |
SDPSVPVEPEDDDMVDQ
|
17 | Aedes aegypti | NPY | sNPF-associated peptide (By similarity) | ||
| NP04210 |
NFDEIDRYSTFG
|
12 | Aedes aegypti | Orcokinin | Orcokinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04432 |
GPTVGLFAFPRV
|
12 | Aedes aegypti | Periviscerokinin | CAPA-Periviscerokinin-1 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04433 |
QGLVPFPRV
|
9 | Aedes aegypti | Periviscerokinin | CAPA-Periviscerokinin-2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP04958 |
AGNSGANSGMWFGPRL
|
16 | Aedes aegypti | Pyrokinin | CAPA-Pyrokinin | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05003 |
AAAMWFGPRL
|
10 | Aedes aegypti | Pyrokinin | AAAMWFGPRL-amide (By similarity) | ||
| NP05004 |
DASSSNENNSRPPFAPRL
|
18 | Aedes aegypti | Pyrokinin | DASSSNENNSRPPFAPRL-amide (By similarity) | ||
| NP05005 |
NLPFSPRL
|
8 | Aedes aegypti | Pyrokinin | NLPFSPRL-amide (By similarity) | ||
| NP05006 |
QPQPVFYHSTTPRL
|
14 | Aedes aegypti | Pyrokinin | QPQPVFYHSTTPRL-amide (By similarity) | ||
| NP05545 |
VPSGFTGMR
|
9 | Aedes aegypti | Tachykinin | Tachykinin-related peptide 2 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05546 |
VPNGFLGVR
|
9 | Aedes aegypti | Tachykinin | Tachykinin-related peptide 5 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05547 |
APSGFLGLR
|
9 | Aedes aegypti | Tachykinin | TKRP-1 and 4 | 20163154#Predel R, Neupert S, Garczynski SF, Crim JW, Brown MR, Russell WK, Kahnt J, Russell DH, Nachman RJ#Neuropeptidomics of the mosquito Aedes aegypti#J Proteome Res 2010 Apr 5;9(4):2006-15 | |
| NP05608 |
NTGDKFYGLM
|
10 | Aedes aegypti | Tachykinin | Sialokinin | 8278354#Champagne D.E., Ribeiro J.M.C.; #Sialokinin I and II: vasodilatory tachykinins from the yellow fever mosquito Aedes aegypti.; #Proc. Natl. Acad. Sci. U.S.A. 91:138-142(1994). |